PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01465.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 400aa    MW: 43896.2 Da    PI: 6.9578
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01465.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-1862115356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k++++++eq+e Le  F+++r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  Zpz_sc01465.1.g00080.1.am.mk  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHK 115
                                   45589***********************************************99 PP

2HD-ZIP_I/II113.21.7e-3662152292
                   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                                   kkrrls+eqv++LE sF+ee+kLe+ rKv+la eLgl+p+qvavWFqnrRAR+k+k lE+++ +Lk+a+da   ++++Le+
  Zpz_sc01465.1.g00080.1.am.mk  62 KKRRLSDEQVEMLELSFREERKLETGRKVHLAAELGLDPKQVAVWFQNRRARHKSKLLEEEFVKLKQAHDAAILHKCHLEN 142
                                   9******************************************************************************** PP

                   HD-ZIP_I/II  83 eveeLreelk 92 
                                   ev +L+e+l+
  Zpz_sc01465.1.g00080.1.am.mk 143 EVLRLKERLM 152
                                   ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.47157117IPR001356Homeobox domain
SMARTSM003894.9E-1760121IPR001356Homeobox domain
SuperFamilySSF466893.04E-1661116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-1762115IPR009057Homeodomain-like
PfamPF000466.3E-1662115IPR001356Homeobox domain
CDDcd000866.65E-1562117No hitNo description
PRINTSPR000312.8E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000312.8E-597113IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MEQYAEQQHQ LFPSSSVDLD SSLLAATGAA QGEERPRARR RRRRAARCGG ADGVEVDAED  60
PKKRRLSDEQ VEMLELSFRE ERKLETGRKV HLAAELGLDP KQVAVWFQNR RARHKSKLLE  120
EEFVKLKQAH DAAILHKCHL ENEVLRLKER LMVAEEELTR LRSAGSHAIS GDGVDVMGRV  180
VCSGSPSSSF SAGTCHQQLG VGGVDDDLIY VPDVADYVYA DNTVVEWFSL FGLMEFYLGS  240
PCIRGRKRPS HELAFQFTSP WSIEANAPIE TAAPGSFVEE DITISDKVPG ASAATLARSD  300
TREHATRTAD LAVQATAGRA IDALNMGTAT SELIKPLEQR PRPSRRSHSP QPQAFLQQPD  360
KQQATTDATG DTNAAGGHAR SLARSRARGK PAPPRDFALS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13443RPRARRRRRR
23846RRRRRRAAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9445171e-155EU944517.1 Zea mays clone 221396 mRNA sequence.
GenBankEU9536261e-155EU953626.1 Zea mays clone 1440579 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460922.16e-94hypothetical protein SORBIDRAFT_02g037560
SwissprotQ7XI851e-85HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLC5XCG17e-94C5XCG1_SORBI; Putative uncharacterized protein Sb02g037560
STRINGSb02g037560.12e-93(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-38homeobox protein 40